PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00013210-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 219aa    MW: 24609.9 Da    PI: 10.1235
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00013210-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR160.17e-1953138290
                   FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHel 89 
                            +YneYA ++GF +r+ +s+ks+r+g+i++r + C +  + +++ +    +++  ++ r gC+a l vk+e+ g+w+v k++ +HnH+l
  SMil_00013210-RA_Salv  53 YYNEYAGRAGFLTRIISSRKSERDGSIVSRGLGCRNIPNIQKSGNI---SNEGGQKRRDGCTAILLVKRENGGRWVVRKFVRDHNHSL 137
                            8*********************************999888887766...6777888999****************************9 PP

                   FAR1  90 a 90 
                            +
  SMil_00013210-RA_Salv 138 V 138
                            7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.5E-1653138IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MLSVVVDVEA TPDGGNGLME ASVAGDFATC EAERNAEPYV GMVFETEAAA RAYYNEYAGR  60
AGFLTRIISS RKSERDGSIV SRGLGCRNIP NIQKSGNISN EGGQKRRDGC TAILLVKREN  120
GGRWVVRKFV RDHNHSLVAS LPKRRPTFDE KDKRIQELTA ELRVKKRLSA AYREQLLILM  180
KDVENHTDHL TSKVQMTRNN LKELEARRQQ LSNHNKPSL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073899.11e-125PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_011073900.11e-125PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_011073901.11e-125PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
TrEMBLA0A022RAG61e-122A0A022RAG6_ERYGU; Uncharacterized protein
STRINGSolyc06g073210.2.12e-97(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA130991718
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43280.16e-42FAR1 family protein